Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 7(CEACAM7)

Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 7(CEACAM7)

CSB-EP005167HU
Regular price
$591.00 USD
Sale price
$591.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Tags & Cell Markers

Target / Protein: CEACAM7

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Homo sapiens (Human)

Delivery time: 3-7 business days

Uniprot ID: Q14002

AA Sequence: TNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGFYTLHVIKENLVNEEVTRQFYVFSEPPKPSITSNNFNPVENKDIVVLTCQPETQNTTYLWWVNNQSLLVSPRLLLSTDNRTLVLLSATKNDIGPYECEIQNPVGASRSDPVTLNVRYESVQAS

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 36-242aa

Protein length: Full Length

MW: 39.4 kDa

Alternative Name(s): Carcinoembryonic antigen CGM2

Relevance:

Reference: "CGM2, a member of the carcinoembryonic antigen gene family is down-regulated in colorectal carcinomas."Thompson J., Zimmermann W., Nollau P., Neumaier M., Weber-Arden J., Schrewe H., Craig I., Willcocks T.J. Biol. Chem. 269:32924-32931(1994)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 7(CEACAM7)
    Regular price
    $591.00 USD
    Sale price
    $591.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 8(CEACAM8)
    Regular price
    $591.00 USD
    Sale price
    $591.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 6(CEACAM6)
    Regular price
    $591.00 USD
    Sale price
    $591.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 8(CEACAM8)
    Regular price
    $591.00 USD
    Sale price
    $591.00 USD
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share