
Size:1mg. Other sizes are also available. Please contact us.
Research Areas:Immunology
Uniprot NO.:Q8WTT0
Uniprot Entry Name:
Gene Names:CLEC4C
Species:Homo sapiens (Human)
Source:E.coli
Expression Region:45-213aa
Sequence:NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI
Protein Description:Extracellular Domain
Tag Info:N-terminal 6xHis-SUMO-tagged
Mol. Weight:36 kDa
Biological_Activity:Measured by its binding ability in a functional ELISA. Immobilized CLEC4C protein at 1 ?g/ml can bind human CLEC4C antibody, the EC50 of human CLEC4C antibody is 31.43-43.52 ?g/ml.
Purity:Greater than 90% as determined by SDS-PAGE.
Endotoxin:Not test.
Form:Lyophilized powder
Buffer:Lyophilized from 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Alternative Name/ Alias:Blood dendritic cell antigen 2 ;BDCA-2;C-type lectin superfamily member 7Dendritic lectin; CD303
Relevance:Involved in antigen-capturing. Target ligand into antigen processing and peptide-loading compartments for presentation to T-cells. May mediate potent inhibition of induction of IFN-alpha/beta expression in plasmacytoid dendritic cells. May act as a signaling receptor that activates protein-tyrosine kinases and mobilizes intracellular calcium. Does not se to bind mannose.
PubMed ID:
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link:
You may also like
-
Recombinant Human C-type lectin domain family 4 member C(CLEC4C),partial
- Regular price
- $847.00 USD
- Sale price
- $847.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse C-type lectin domain family 4 member G(Clec4g),partial
- Regular price
- $862.00 USD
- Sale price
- $862.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human CD44 antigen(CD44),partial,Biotinylated (Active)
- Regular price
- $636.00 USD
- Sale price
- $636.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human C-type lectin domain family 4 member C(CLEC4C),partial
- Regular price
- $584.00 USD
- Sale price
- $584.00 USD
- Regular price
-
- Unit price
- per
Sold out