Recombinant Human Atypical chemokine receptor 1(ACKR1) (Active)

Recombinant Human Atypical chemokine receptor 1(ACKR1) (Active)

CSB-CF624105HU
Regular price
$2,113.00 USD
Sale price
$2,113.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size:20ug. Other sizes are also available. Please contact us.

Research Areas:Cardiovascular

Uniprot NO.:Q16570

Uniprot Entry Name:

Gene Names:ACKR1

Species:Homo sapiens (Human)

Source:in vitro E.coli expression system

Expression Region:1-336aa

Sequence:MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDSALPFFILTSVLGILASSTVLFMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPVLAPGLGSTRSSALCSLGYCVWYGSAFAQALLLGCHASLGHRLGAGQVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYSTELKALQATHTVACLAIFVLLPLGLFGAKGLKKALGMGPGPWMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQALDLLLNLAEALAILHCVATPLLLALFCHQATRTLLPSLPLPEGWSSHLDTLGSKS

Protein Description:Full Length

Tag Info:N-terminal 10xHis-tagged

Mol. Weight:41.1 kDa

Biological_Activity:Measured by its binding ability in a functional ELISA. Immobilized ACKR1 at 1 ?g/ml can bind human CCL2, the EC50 of human CCL2 protein is 48.64-60.24 ?g/ml.

Purity:Greater than 85% as determined by SDS-PAGE.

Endotoxin:Not test.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Alternative Name/ Alias:Duffy antigen/chemokine receptor Fy glycoprotein Short name: GpFy Glycoprotein D Plasmodium vivax receptor CD_antigen: CD234 DARC, FY, GPD

Relevance:Atypical chemokine receptor that controls chemokine levels and localization via high-affinity chemokine binding that is uncoupled from classic ligand-driven signal transduction cascades, resulting instead in chemokine sequestration, degradation, or transcytosis. Also known as interceptor (internalizing receptor) or chemokine-scavenging receptor or chemokine decoy receptor. Has a promiscuous chemokine-binding profile, interacting with inflammatory chemokines of both the CXC and the CC subfamilies but not with homeostatic chemokines. Acts as a receptor for chemokines including CCL2, CCL5, CCL7, CCL11, CCL13, CCL14, CCL17, CXCL5, CXCL6, IL8/CXCL8, CXCL11, GRO, RANTES, MCP-1, TARC and also for the malaria parasites P.vivax and P.knowlesi. May regulate chemokine bioavailability and, consequently, leukocyte recruitment through two distinct mechanisms: when expressed in endothelial cells, it sustains the abluminal to luminal transcytosis of tissue-derived chemokines and their subsequent presentation to circulating leukocytes; when expressed in erythrocytes, serves as blood reservoir of cognate chemokines but also as a chemokine sink, buffering potential surges in plasma chemokine levels.

PubMed ID:

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

You may also like

  • Recombinant Human Atypical chemokine receptor 2(ACKR2) (Active)
    Regular price
    $2,186.00 USD
    Sale price
    $2,186.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human C-C chemokine receptor type 2(CCR2) (Active)
    Regular price
    $2,171.00 USD
    Sale price
    $2,171.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Ubiquitin-associated domain-containing protein 1(UBAC1) (Active)
    Regular price
    $654.00 USD
    Sale price
    $654.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human ACKR2
    Regular price
    $474.00 USD
    Sale price
    $474.00 USD
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share