
Size: 10ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 15-20 working days
Research Topic: Cardiovascular
Uniprot ID: P20292
Gene Names: ALOX5AP
Organism: Homo sapiens (Human)
AA Sequence: MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP
Expression Region: 1-161aa
Sequence Info: Full Length
Source: in vitro E.coli expression system
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 34.2 kDa
Alternative Name(s): FLAP MK-886-binding protein
Relevance: Required for leukotriene biosynthesis by ALOX5 (5-lipoxygenase). Anchors ALOX5 to the membrane. Binds arachidonic acid, and could play an essential role in the transfer of arachidonic acid to ALOX5. Binds to MK-886, a compound that blocks the biosynthesis of leukotrienes.
Reference: "Requirement of a 5-lipoxygenase-activating protein for leukotriene synthesis." Dixon R.A.F., Diehl R.E., Opas E., Rands E., Vickers P.J., Evans J.F., Gillard J.W., Miller D.K. Nature 343:282-284(1990)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Pig Arachidonate 5-lipoxygenase-activating protein(ALOX5AP)
- Regular price
- $1,261.00 USD
- Sale price
- $1,261.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Rabbit Arachidonate 5-lipoxygenase-activating protein(ALOX5AP)
- Regular price
- $1,261.00 USD
- Sale price
- $1,261.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Sheep Arachidonate 5-lipoxygenase-activating protein(ALOX5AP)
- Regular price
- $1,261.00 USD
- Sale price
- $1,261.00 USD
- Regular price
-
- Unit price
- per
Sold out -
5 Lipoxygenase antibody , Cat. # FNab00007
- Regular price
- $424.00 USD
- Sale price
- $424.00 USD
- Regular price
-
- Unit price
- per
Sold out