
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Neuroscience
Target / Protein: SNCA
Biologically active: Not Tested
Expression system: Yeast
Species of origin: Homo sapiens (Human)
Delivery time: 3-7 business days
Uniprot ID: P37840
AA Sequence: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Tag info: N-terminal 6xHis-tagged
Expression Region: 1-140aa
Protein length: Full Length
MW: 16.5 kDa
Alternative Name(s): Non-A beta component of AD amyloidNon-A4 component of amyloid precursor ;NACP
Relevance: May be involved in the regulation of dopamine release and transport. Induces fibrillization of microtubule-associated protein tau. Reduces neuronal responsiveness to various apoptotic stimuli, leading to a decreased caspase-3 activation.
Reference: Molecular cloning of cDNA encoding an unrecognized component of amyloid in Alzheimer disease.Ueda K., Fukushima H., Masliah E., Xia Y., Iwai A., Yoshimoto M., Otero D.A., Kondo J., Ihara Y., Saitoh T.Proc. Natl. Acad. Sci. U.S.A. 90:11282-11286(1993)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.