Recombinant Human Alpha-synuclein protein(SNCA)

Recombinant Human Alpha-synuclein protein(SNCA)

CSB-YP021912HU
Regular price
$668.00 USD
Sale price
$668.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Neuroscience

Target / Protein: SNCA

Biologically active: Not Tested

Expression system: Yeast

Species of origin: Homo sapiens (Human)

Delivery time: 3-7 business days

Uniprot ID: P37840

AA Sequence: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA

Tag info: N-terminal 6xHis-tagged

Expression Region: 1-140aa

Protein length: Full Length

MW: 16.5 kDa

Alternative Name(s): Non-A beta component of AD amyloidNon-A4 component of amyloid precursor ;NACP

Relevance: May be involved in the regulation of dopamine release and transport. Induces fibrillization of microtubule-associated protein tau. Reduces neuronal responsiveness to various apoptotic stimuli, leading to a decreased caspase-3 activation.

Reference: Molecular cloning of cDNA encoding an unrecognized component of amyloid in Alzheimer disease.Ueda K., Fukushima H., Masliah E., Xia Y., Iwai A., Yoshimoto M., Otero D.A., Kondo J., Ihara Y., Saitoh T.Proc. Natl. Acad. Sci. U.S.A. 90:11282-11286(1993)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Human Alpha-synuclein protein(SNCA)
    Regular price
    $668.00 USD
    Sale price
    $668.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Alpha-synuclein(SNCA)
    Regular price
    $598.00 USD
    Sale price
    $598.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Alpha-synuclein(SNCA),partial
    Regular price
    $598.00 USD
    Sale price
    $598.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Mouse Alpha-synuclein(Snca)
    Regular price
    $992.00 USD
    Sale price
    $992.00 USD
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share