
Size:100ug. Other sizes are also available. Please contact us.
Research Areas:Others
Uniprot NO.:P56112
Uniprot Entry Name:
Gene Names:HP-0175
Species:Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)
Source:E.coli
Expression Region:22-299aa
Sequence:KPAHNANNATHNTKKTTDSSAGVLATVDGRPITKSDFDMIKQRNPNFDFDKLKEKEKEALIDQAIRTALVENEAKTEKLDSTPEFKAMMEAVKKQALVEFWAKKQAEEVKKVQIPEKEMQDFYNANKDQLFVKQEAHARHILVKTEDEAKRIISEIDKQPKAKKEAKFIELANRDTIDPNSKNAQNGGDLGKFQKNQMAPDFSKAAFALTPGDYTKTPVKTEFGYHIIYLISKDSPVTYTYEQAKPTIKGMLQEKLFQERMNQRIEELRKHAKIVINK
Protein Description:Full Length
Tag Info:N-terminal GST-tagged
Mol. Weight:58.8 kDa
Biological_Activity:Measured by its binding ability in a functional ELISA. Immobilized yuaB at 5 ?g/ml can bind human HP_0175 with a linear range of 31.25-600.00 ng/ml.
Purity:Greater than 90% as determined by SDS-PAGE.
Endotoxin:Not test.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Alternative Name/ Alias:Rotamase HP_0175
Relevance:
PubMed ID:
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link:
You may also like
-
Recombinant Helicobacter pylori 60 kDa chaperonin(groL),partial
- Regular price
- $868.00 USD
- Sale price
- $868.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Helicobacter pylori Putative biopolymer transport protein exbB-like 1 (HP_1130)
- Regular price
- $1,270.00 USD
- Sale price
- $1,270.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Helicobacter pylori Prolipoprotein diacylglyceryl transferase(lgt)
- Regular price
- $1,354.00 USD
- Sale price
- $1,354.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Helicobacter pylori Protease HtpX homolog(htpX)
- Regular price
- $1,376.00 USD
- Sale price
- $1,376.00 USD
- Regular price
-
- Unit price
- per
Sold out