
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: others
Target / Protein: fanC
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Escherichia coli
Delivery time: 3-7 business days
Uniprot ID: P18103
AA Sequence: NTGTINFNGKITSATCTIDPEVNGNRTSTIDLGQAAISGHGTVVDFKLKPAPGSNDCLAKTNARIDWSGSMNSLGFNNTASGNTAAKGYHMTLRATNVGNGSGGANINTSFTTAEYTHTSAIQSFNYSAQLKKDDRAPSNGGYKAGVFTTSASFLVTYM
Tag info: N-terminal 6xHis-SUMO-tagged
Expression Region: 23-181aa
Protein length: Full Length of Mature Protein
MW: 32.5 kDa
Alternative Name(s):
Relevance: Fimbriae (also called pili), polar filaments radiating from the surface of the bacterium to a length of 0.5-1.5 micrometers and numbering 100-300 per cell, enable bacteria to colonize the epithelium of specific host organs. FanC is the main component of the K99 fimbriae.
Reference: "The role of lysine-132 and arginine-136 in the receptor-binding domain of the K99 fibrillar subunit." Jacobs A.A.C., Simons L.H., de Graaf F.K. EMBO J. 6:1805-1808(1987)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Escherichia coli K99 fimbrial protein(fanC)
- Regular price
- $866.00 USD
- Sale price
- $866.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Escherichia coli K99 fimbrial protein(fanC)
- Regular price
- $742.00 USD
- Sale price
- $742.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Escherichia coli K99 fimbrial protein(fanC)
- Regular price
- $742.00 USD
- Sale price
- $742.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Escherichia coli Type-1 fimbrial protein, A chain(fimA)
- Regular price
- $866.00 USD
- Sale price
- $866.00 USD
- Regular price
-
- Unit price
- per
Sold out