Recombinant Escherichia coli Cytolethal distending toxin subunit B(cdtB)

Recombinant Escherichia coli Cytolethal distending toxin subunit B(cdtB)

CSB-EP671598ENL
Regular price
$868.00 USD
Sale price
$868.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: others

Target / Protein: cdtB

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Escherichia coli

Delivery time: 3-7 business days

Uniprot ID: Q46669 

AA Sequence: DLTDFRVATWNLQGASATTESKWNINVRQLISGENAVDILAVQEAGSPPSTAVDTGTLIPSPGIPVRELIWNLSTNSRPQQVYIYFSAVDALGGRVNLALVSNRRADEVFVLSPVRQGGRPLLGIRIGNDAFFTAHAIAMRNNDAPALVEEVYNFFRDSRDPVHQALNWMILGDFNREPADLEMNLTVPVRRASEIISPAAATQTSQRTLDYAVAGNSVAFRPSPLQAGIVYGARRTQISSDHFPVGVSRR

Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Expression Region: 19-269aa

Protein length: Full Length of Mature Protein

MW: 47.4 kDa

Alternative Name(s): Deoxyribonuclease CdtB (EC:3.1.-.-)

Relevance: Part of the tripartite complex that is required for the CDT activity. CdtB exhibits a DNA-nicking endonuclease activity, and very probably causes DNA damage in intoxicated cells. This damage induces G2/M cell cycle arrest, chromatin fragmentation, cell distention and nucleus enlargement.

Reference: "Cloning, sequencing, and expression of the Escherichia coli cytolethal distending toxin genes."Pickett C.L., Cottle D.L., Pesci E.C., Bikah G.Infect. Immun. 62:1046-1051(1994)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share