
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P13198
Gene Names: LMP1
Organism: Epstein-Barr virus (strain Raji) (HHV-4) (Human herpesvirus 4)
AA Sequence: YYHGQRHSDEHHHDDSLPHPQQATDDSSNQSDSNSNEGRHLLLVSGAGDGPPLCSQNLGAPGGGPNNGPQDPDNTDDNGPQDPDNTDDNGPHDPLPQDPDNTDDNGPQDPDNTDDNGPHDPLPHNPSDSAGNDGGPPQLTEEVENKGGDQGPPLMTDGGGGHSHDSGHDGIDPHLPTLLLGTSGSGGDDDDPHGPVQLSYYD
Expression Region: 185-386aa
Sequence Info: Cytoplasmic Domain
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 37 kDa
Alternative Name(s): Protein p63
Relevance: Acts as a CD40 functional homolog to prevent apoptosis of infected B-lymphocytes and drive their proliferation. Functions as a constitutively active tumor necrosis factor receptor that induces the activation of several signaling pathways, including those of the NF-kappa-B family. LMP1 signaling leads to up-regulation of antiapoptotic proteins and provide growth signals in latently infected cells. It is a short-lived protein probably degraded by the proteasome .
Reference: Sequence analysis of Raji Epstein-Barr virus DNA.Hatfull G., Bankier A.T., Barrell B.G., Farrell P.J.Virology 164:334-340(1988)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Epstein-Barr virus Latent membrane protein 1(LMP1),partial
- Regular price
- $990.00 USD
- Sale price
- $990.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Epstein-Barr virus Latent membrane protein 1(LMP1),partial
- Regular price
- $768.00 USD
- Sale price
- $768.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Epstein-Barr virus Latent membrane protein 1(LMP1),partial
- Regular price
- $990.00 USD
- Sale price
- $990.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Epstein-Barr virus Latent membrane protein 1(LMP1),partial
- Regular price
- $990.00 USD
- Sale price
- $990.00 USD
- Regular price
-
- Unit price
- per
Sold out