Recombinant Danio rerio Superoxide dismutase [Cu-Zn] (sod1)

Recombinant Danio rerio Superoxide dismutase [Cu-Zn] (sod1)

CSB-EP022397DIL
Regular price
$896.00 USD
Sale price
$896.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Signal Transduction

Target / Protein: sod1

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Danio rerio (Zebrafish) (Brachydanio rerio)

Delivery time: 3-7 business days

Uniprot ID: O73872

AA Sequence: MVNKAVCVLKGTGEVTGTVYFNQEGEKKPVKVTGEITGLTPGKHGFHVHAFGDNTNGCISAGPHFNPHDKTHGGPTDSVRHVGDLGNVTADASGVAKIEIEDAMLTLSGQHSIIGRTMVIHEKEDDLGKGGNEESLKTGNAGGRLACGVIGITQ

Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Expression Region: 1-154aa

Protein length: Full Length

MW: 37.1 kDa

Alternative Name(s):

Relevance: Destroys radicals which are normally produced within the cells and which are toxic to biological systems.

Reference: "Comparative effects of dietary methylmercury on gene expression in liver, skeletal muscle, and brain of the zebrafish (Danio rerio)." Gonzalez P., Dominique Y., Massabuau J.C., Boudou A., Bourdineaud J.P. Environ. Sci. Technol. 39:3972-3980(2005)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share