Recombinant Dahlia merckii Defensin-like protein 1

Recombinant Dahlia merckii Defensin-like protein 1

CSB-EP316614DAE
Regular price
$896.00 USD
Sale price
$896.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: others

Target / Protein:

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Dahlia merckii (Bedding dahlia)

Delivery time: 3-7 business days

Uniprot ID: P0C8Y4

AA Sequence: ELCEKASKTWSGNCGNTGHCDNQCKSWEGAAHGACHVRNGKHMCFCYFNC

Tag info: N-terminal 6xHis-B2M-tagged

Expression Region: 1-50aa

Protein length: Full Length

MW: 19.5 kDa

Alternative Name(s): Cysteine-rich antimicrobial protein 1 Defensin AMP1

Relevance: Possesses antimicrobial activity sensitive to inorganic cations. Has no inhibitory effect on insect gut alpha-amylase. Induces potential changes in fungal membranes and increased K+ efflux and Ca2+ uptake. Interacts with sphingolipids and ergosterols found in fungal plasma membranes.

Reference: "Fungal membrane responses induced by plant defensins and thionins." Thevissen K., Ghazi A., De Samblanx G.W., Brownlee C., Osborn R.W., Broekaert W.F. J. Biol. Chem. 271:15018-15025(1996)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Dahlia merckii Defensin-like protein 1
    Regular price
    $896.00 USD
    Sale price
    $896.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Raphanus sativus Defensin-like protein 2(AFP2)
    Regular price
    $896.00 USD
    Sale price
    $896.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Raphanus sativus Defensin-like protein 2(AFP2)
    Regular price
    $896.00 USD
    Sale price
    $896.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Neutrophil defensin 1(DEFA1)
    Regular price
    $762.00 USD
    Sale price
    $762.00 USD
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share