Recombinant Cupressus arizonica Pectate lyase 1

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Cupressus arizonica Pectate lyase 1

CSB-EP871029COAD
Regular price
$897.00 USD
Sale price
$897.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170725

Research areas: others

Target / Protein:

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Cupressus arizonica (Arizona cypress) (Callitropsis arizonica)

Delivery time: 3-7 business days

Uniprot ID: Q9SCG9

AA Sequence: DNPIDSCWRGDSNWDQNRMKLADCVVGFGSSTMGGKGGEIYTVTSSEDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGADVHLGNGGPCLFMRKASHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNESYKKEVTKRIGCETTSACANWVWRSTRDAFTNGAYFVSSGKAEDTNIYNSNEAFKVENGNAAPQLTQNAGVVA

Tag info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 22-367aa

Protein length: Full Length of Mature Protein

MW: 42.6 kDa

Alternative Name(s): Major pollen allergen Cup a 1 Allergen: Cup a 1

Relevance: Has pectate lyase activity.

Reference: "A modified protocol for RNA isolation from high polysaccharide containing Cupressus arizonica pollen. Applications for RT-PCR and phage display library construction." Pico de Coana Y., Parody N., Fernandez-Caldas E., Alonso C. Mol. Biotechnol. 44:127-132(2010)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Cupressus arizonica Pectate lyase 1
    Regular price
    $897.00 USD
    Sale price
    $897.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Cupressus arizonica Pectate lyase 1
    Regular price
    $897.00 USD
    Sale price
    $897.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Ambrosia artemisiifolia Pectate lyase 5
    Regular price
    $897.00 USD
    Sale price
    $897.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Juniperus ashei Pectate lyase 1
    Regular price
    $759.00 USD
    Sale price
    $759.00 USD
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share