Recombinant Cricetulus griseus Cathepsin D(CTSD) ,partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Cricetulus griseus Cathepsin D(CTSD) ,partial

CSB-EP006187DXU
Regular price
$908.00 USD
Sale price
$908.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170725

Research areas: Others

Target / Protein: CTSD

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)

Delivery time: 3-7 business days

Uniprot ID: G3I4W7

AA Sequence: GPVSELLKNYLDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSGKSSTFVKNGTSFDIHYGSGSLSGYLSQDTVSVPCKSEQPGGLKVEKQIFGEAIKQPGITFIAAKFDGILGMGYPSISVNNVVPVFDNLMQQKLVEKNIFSFFLNRDPTGQPGGELMLGGIDSKYYEGELSYLNVTRKAYWQVHMDQLDVANGLTLCKGGCEAIVDTGTSLLVGPVDEVKELQKAIGAVPLIQGEYMIPCEKVSSLPSVTLKLGGKDYELSPSKYVLKVSQGGKTICLSGFMGMDIPPPSGPLWILGDVFIGTYYTVFDRDNNRVGFAKAATL

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 65-408aa

Protein length: Partial

MW: 53.3 kDa

Alternative Name(s):

Relevance:

Reference: The genomic sequence of the Chinese hamster ovary (CHO)-K1 cell line.Xu X., Nagarajan H., Lewis N.E., Pan S., Cai Z., Liu X., Chen W., Xie M., Wang W., Hammond S., Andersen M.R., Neff N., Passarelli B., Koh W., Fan H.C., Wang J., Gui Y., Lee K.H. , Betenbaugh M.J., Quake S.R., Famili I., Palsson B.O., Wang J.Nat. Biotechnol. 29:735-741(2011)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Cricetulus griseus Cathepsin D(CTSD) ,partial
    Regular price
    $908.00 USD
    Sale price
    $908.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Cricetulus griseus C-C motif chemokine
    Regular price
    $908.00 USD
    Sale price
    $908.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Cricetulus griseus Sialidase-2 (NEU2)
    Regular price
    $816.00 USD
    Sale price
    $816.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Cricetulus griseus Phosphoglycerate kinase 1(PGK1)
    Regular price
    $1,000.00 USD
    Sale price
    $1,000.00 USD
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share