>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170725
Research areas: Others
Target / Protein: CTSD
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)
Delivery time: 3-7 business days
Uniprot ID: G3I4W7
AA Sequence: GPVSELLKNYLDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSGKSSTFVKNGTSFDIHYGSGSLSGYLSQDTVSVPCKSEQPGGLKVEKQIFGEAIKQPGITFIAAKFDGILGMGYPSISVNNVVPVFDNLMQQKLVEKNIFSFFLNRDPTGQPGGELMLGGIDSKYYEGELSYLNVTRKAYWQVHMDQLDVANGLTLCKGGCEAIVDTGTSLLVGPVDEVKELQKAIGAVPLIQGEYMIPCEKVSSLPSVTLKLGGKDYELSPSKYVLKVSQGGKTICLSGFMGMDIPPPSGPLWILGDVFIGTYYTVFDRDNNRVGFAKAATL
Tag info: N-terminal 6xHis-SUMO-tagged
Expression Region: 65-408aa
Protein length: Partial
MW: 53.3 kDa
Alternative Name(s):
Relevance:
Reference: The genomic sequence of the Chinese hamster ovary (CHO)-K1 cell line.Xu X., Nagarajan H., Lewis N.E., Pan S., Cai Z., Liu X., Chen W., Xie M., Wang W., Hammond S., Andersen M.R., Neff N., Passarelli B., Koh W., Fan H.C., Wang J., Gui Y., Lee K.H. , Betenbaugh M.J., Quake S.R., Famili I., Palsson B.O., Wang J.Nat. Biotechnol. 29:735-741(2011)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.