Recombinant Carica papaya Papain

Recombinant Carica papaya Papain

CSB-EP365471DQH
Regular price
$868.00 USD
Sale price
$868.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Allergen

Target / Protein:

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Carica papaya (Papaya)

Delivery time: 3-7 business days

Uniprot ID: P00784 

AA Sequence: IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN

Tag info: N-terminal 6xHis-tagged

Expression Region: 134-345aa

Protein length: Full Length

MW: 27.4 kDa

Alternative Name(s): Papaya proteinase I Short name:PPI

Relevance: Catalytic activityi Hydrolysis of proteins with broad specificity for peptide bonds, but preference for an amino acid bearing a large hydrophobic side chain at the P2 position. Does not accept Val in P1'.

Reference: "Structure of papain."Drenth J., Jansonius J.N., Koekoek R., Swen H.M., Wolthers B.G.Nature 218:929-932(1968)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share