Gene Bio Systems
Recombinant Carbepenem-hydrolyzing beta-lactamase KPC(bla)
Recombinant Carbepenem-hydrolyzing beta-lactamase KPC(bla)
SKU:CSB-EP802889KBE
Couldn't load pickup availability
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170725
Research areas: Others
Target / Protein: bla
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Klebsiella oxytoca
Delivery time: 3-7 business days
Uniprot ID: Q848S6
AA Sequence: LTNLVAEPFAKLEQDFGGSIGVYAMDTGSGATVSYRAEERFPLCSSFKGFLAAAVLARSQQQAGLLDTPIRYGKNALVPWSPISEKYLTTGMTVAELSAAAVQYSDNAAANLLLKELGGPAGLTAFMRSIGDTTFRLDRWELELNSAIPGDARDTSSPRAVTESLQKLTLGSALAAPQRQQFVDWLKGNTTGNHRIRAAVPADWAVGDKTGTCGVYGTANDYAVVWPTGRAPIVLAVYTRAPNKDDKHSEAVIAAAARLALEGLGVNGQ
Tag info: N-terminal 6xHis-SUMO-tagged
Expression Region: 25-293aa
Protein length: Full Length of Mature Protein
MW: 44.5 kDa
Alternative Name(s): Carbapenem-hydrolyzing beta-lactamase KPC-2
Relevance: Hydrolyzes carbapenems, penicillins, cephalosporins and aztreonam with varying efficiency.
Reference: "Carbapenem-resistant strain of Klebsiella oxytoca harboring carbapenem-hydrolyzing beta-lactamase KPC-2."Yigit H., Queenan A.M., Rasheed J.K., Biddle J.W., Domenech-Sanchez A., Alberti S., Bush K., Tenover F.C.Antimicrob. Agents Chemother. 47:3881-3889(2003)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
