Recombinant Bovine Interferon omega-1(IFNW1)

Recombinant Bovine Interferon omega-1(IFNW1)

CSB-EP011061BO-GB
Regular price
$868.00 USD
Sale price
$868.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Immunology

Target / Protein: IFNW1

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Bos taurus (Bovine)

Delivery time: 3-7 business days

Uniprot ID: P07352

AA Sequence: CDLSPNHVLVGRQNLRLLGQMRRLSPRFCLQDRKDFAFPQEMVEVSQFQEAQAISVLHEMLQQSFNLFHKERSSAAWDTTLLEQLLTGLHQQLDDLDACLGLLTGEEDSALGRTGPTLAMKRYFQGIHVYLQEKGYSDCAWEIVRLEIMRSLSSSTSLQERLRMMDGDLKSP

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 24-195AA

Protein length: Full Length of Mature Protein

MW: 35.7 kDa

Alternative Name(s): IFN-omega-c1 Interferon alpha-II-1

Relevance:

Reference: "Two distinct families of human and bovine interferon-alpha genes are coordinately expressed and encode functional polypeptides." Capon D.J., Shepard H.M., Goeddel D.V. Mol. Cell. Biol. 5:768-779(1985)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share