
Size:100ug. Other sizes are also available. For further information, please contact us.
Research Areas:Others
Uniprot ID:P35131
Gene Names:UBC8
Organism:Arabidopsis thaliana (Mouse-ear cress)
AA Sequence:MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPAESPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYEATARNWTQKYAMG
Expression Region:1-148aa
Sequence Info:Full Length
Source:E.coli
Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW:24.0 kDa
Alternative Name(s):E2 ubiquitin-conjugating enzyme 8;UBCAT4A;Ubiquitin carrier protein 8;Ubiquitin-conjugating enzyme E2-17 kDa 8;Ubiquitin-protein ligase 8
Relevance:Accepts the ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. Mediates the selective degradation of short-lived and abnormal proteins.
Reference:"Genome analysis and functional characterization of the E2 and RING-type E3 ligase ubiquitination enzymes of Arabidopsis." Kraft E., Stone S.L., Ma L., Su N., Gao Y., Lau O.-S., Deng X.-W., Callis J. Plant Physiol. 139:1597-1611(2005)
Purity:Greater than 90% as determined by SDS-PAGE.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link:
Lead Time Guidance:3-7 business days
You may also like
-
Recombinant Arabidopsis thaliana UDP-glycosyltransferase 72B1(UGT72B1)
- Regular price
- $893.00 USD
- Sale price
- $893.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Arabidopsis thaliana Ubiquitin-conjugating enzyme E2 32(UBC32)
- Regular price
- $1,415.00 USD
- Sale price
- $1,415.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human E3 ubiquitin-protein ligase RNF8(RNF8)
- Regular price
- $617.00 USD
- Sale price
- $617.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Arabidopsis thaliana UDP-glycosyltransferase 72E2(UGT72E2)
- Regular price
- $893.00 USD
- Sale price
- $893.00 USD
- Regular price
-
- Unit price
- per
Sold out