Recombinant Arabidopsis thaliana GRF1-interacting factor 1(GIF1)

Recombinant Arabidopsis thaliana GRF1-interacting factor 1(GIF1)

CSB-EP781430DOA
Regular price
$889.00 USD
Sale price
$889.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Signal Transduction

Uniprot ID:Q8L8A5

Gene Names:GIF1

Organism:Arabidopsis thaliana (Mouse-ear cress)

AA Sequence:MQQHLMQMQPMMAGYYPSNVTSDHIQQYLDENKSLILKIVESQNSGKLSECAENQARLQRNLMYLAAIADSQPQPPSVHSQYGSAGGGMIQGEGGSHYLQQQQATQQQQMTQQSLMAARSSMLYAQQQQQQQPYATLQHQQLHHSQLGMSSSSGGGGSSGLHILQGEAGGFHDFGRGKPEMGSGGGGEGRGGSSGDGGETLYLKSSDDGN

Expression Region:1-210aa

Sequence Info:Full Length

Source:E.coli

Tag Info:N-terminal 6xHis-KSI-tagged

MW:37.8 kDa

Alternative Name(s):GRF1-interacting factor 1(AtGIF1)(Protein ANGUSTIFOLIA 3)(Transcription coactivator GIF1)

Relevance:Transcription coactivator that plays a role in the regulation of cell expansion in leaf and cotyledons tissues. Component of a network formed by miR396, the GRFs and their interacting factors (GIFs) acting in the regulation of meristem function, at least partially through the control of cell proliferation (PubMed:19392710). Appears to function synergistically with GRF1 as a transcriptional coactivator. Acts together with GRF5 for the development of appropriate leaf size and shape through the promotion and/or maintenance of cell proliferation activity in leaf primordia. Plays a role in adaxial/abaxial patterning and growth in leaf morphogenesis. GIFs are involved in the positive regulation of cell proliferation of lateral organs in a functionally redundant manner. Together with GATA18/HAN, mediates cotyledon identity by preventing ectopic root formation through the repression of PLT1 expression (PubMed:22669825).

Reference:"Stable establishment of cotyledon identity during embryogenesis in Arabidopsis by ANGUSTIFOLIA3 and HANABA TARANU." Kanei M., Horiguchi G., Tsukaya H. Development 139:2436-2446(2012)

Purity:Greater than 85% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

Lead Time Guidance:13-23 business days

Your list is ready to share