>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20171228
Research areas: Others
Target / Protein: N/A
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Trichosanthes kirilowii (Chinese snake gourd) (Chinese cucumber)
Delivery time: 3-7 business days
Uniprot ID: P09989
AA Sequence: DVSFRLSGATSSSYGVFISNLRKALPNERKLYDIPLLRSSLPGSQRYALIHLTNYADETISVAIDVTNVYIMGYRAGDTSYFFNEASATEAAKYVFKDAMRKVTLPYSGNYERLQTAAGKIRENIPLGLPALDSAITTLFYYNANSAASALMVLIQSTSEAARYKFIEQQIGKRVDKTFLPSLAIISLENSWSALSKQIQIASTNNGQFESPVVLINAQNQRVTITNVDAGVVTSNIALLLNRNNMA
Tag info: N-terminal 6xHis-SUMO-tagged
Expression Region: 24-270aa
Protein length: Full Length of Mature Protein
MW: 43.1 kDa
Alternative Name(s):
Relevance: Inactivates eukaryotic 60S ribosomal subunits.
Reference: Cloning of trichosanthin cDNA and its expression in Escherichia coli.Shaw P.C., Yung M.H., Zhu R.H., Ho W.K.K., Ng T.B., Yeung H.W.Gene 97:267-272(1991)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.