Recombinant Trichoderma reesei Hydrophobin-2(hfb2)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Trichoderma reesei Hydrophobin-2(hfb2)

CSB-YP304437HYEa4
Regular price
$979.56 CAD
Sale price
$979.56 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170725

Research areas: others

Target / Protein: hfb2

Biologically active: Not Tested

Expression system: Yeast

Species of origin: Hypocrea jecorina (Trichoderma reesei)

Delivery time: 3-7 business days

Uniprot ID: P79073

AA Sequence: AVCPTGLFSNPLCCATNVLDLIGVDCKTPTIAVDTGAIFQAHCASKGSKPLCCVAPVADQALLCQKAIGTF

Tag info: N-terminal 6xHis-sumostar-tagged

Expression Region: 16-86aa

Protein length: Full Length of Mature Protein

MW: 23.2 kDa

Alternative Name(s): Hydrophobin II

Relevance: Responsible for spore hydrophobicity and protection.

Reference: "Differential expression of the vegetative and spore-bound hydrophobins of Trichoderma reesei: cloning and characterization of the hfb2 gene." Nakari-Setaelae T., Aro N., Ilmen M., Munoz G., Kalkkinen N., Penttilae M. Eur. J. Biochem. 248:415-423(1997)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share