Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Others
Uniprot ID: P02710
Gene Names: CHRNA1
Organism: Tetronarce californica (Pacific electric ray) (Torpedo californica)
AA Sequence: SEHETRLVANLLENYNKVIRPVEHHTHFVDITVGLQLIQLISVDEVNQIVETNVRLRQQWIDVRLRWNPADYGGIKKIRLPSDDVWLPDLVLYNNADGDFAIVHMTKLLLDYTGKIMWTPPAIFKSYCEIIVTHFPFDQQNCTMKLGIWTYDGTKVSISPESDRPDLSTFMESGEWVMKDYRGWKHWVYYTCCPDTPYLDITYHFIMQRI
Expression Region: 25-234aa
Sequence Info: Extracellular Domain
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 40.8 kDa
Alternative Name(s):
Relevance: After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.
Reference: "Identifying the lipid-protein interface of the Torpedo nicotinic acetylcholine receptor: secondary structure implications." Blanton M.P., Cohen J.B.Biochemistry 33:2859-2872(1994)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.