Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Thalassiosira pseudonana (Marine diatom) (Cyclotella nana)
Uniprot NO.:A0T0U2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSGGSTGERPFSDIITSVRYWIIHTITIPSLFVSGWLFISTGLAYDVFGTPRPNEYFTQD RQQVPLVNDRFSAKQELEDLTKGL
Protein Names:Recommended name: Cytochrome b559 subunit alpha Alternative name(s): PSII reaction center subunit V
Gene Names:Name:psbE
Expression Region:1-84
Sequence Info:full length protein