Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Synechococcus sp. (strain CC9902)
Uniprot NO.:Q3B0C9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSSKKSLYPDGRIPDRLPDGRPAVAWRSRWTEGVLPLWLVATAGGMAVFFVVGLFFFGAY TGVGSA
Protein Names:Recommended name: Photosystem II reaction center protein J Short name= PSII-J
Gene Names:Name:psbJ Ordered Locus Names:Syncc9902_0224
Expression Region:1-66
Sequence Info:full length protein