>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170725
Research areas: Others
Target / Protein: def
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Staphylococcus aureus
Delivery time: 3-7 business days
Uniprot ID: P68826
AA Sequence: MLTMKDIIRDGHPTLRQKAAELELPLTKEEKETLIAMREFLVNSQDEEIAKRYGLRSGVGLAAPQINISKRMIAVLIPDDGSGKSYDYMLVNPKIVSHSVQEAYLPTGEGCLSVDDNVAGLVHRHNRITIKAKDIEGNDIQLRLKGYPAIVFQHEIDHLNGVMFYDHIDKNHPLQPHTDAVEV
Tag info: N-terminal 6xHis-SUMO-tagged
Expression Region: 1-183aa
Protein length: Full Length
MW: 36.6 kDa
Alternative Name(s): Polypeptide deformylase
Relevance: Roves the formyl group from the N-terminal Met of newly synthe>Several Other Sizes Are Also Available. Please Inquire. Default Sized proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminal L-methionine is a prerequisite for activity but the enzyme has broad specificity at other positions .
Reference: Staphylococcus aureus deformylase 1 encoding DNA.Lonetto M.A., Sylvester D.R., Warren R.L. Identification of Staphylococcus aureus proteins recognized by the antibody-mediated immune response to a biofilm infection.Brady R.A., Leid J.G., Camper A.K., Costerton J.W., Shirtliff M.E.Infect. Immun. 74:3415-3426(2006)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.