Recombinant Staphylococcus aureus 30 kDa neutral phosphatase

Recombinant Staphylococcus aureus 30 kDa neutral phosphatase

CSB-EP324148FKZ
Regular price
$1,151.28 CAD
Sale price
$1,151.28 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Microbiology

Target / Protein:

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Staphylococcus aureus

Delivery time: 3-7 business days

Uniprot ID: P21222

AA Sequence: KSSAEVQQTQQASIPASQKANLGNQNNIMSVASYQ

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-35aa

Protein length: Full Length

MW: 19.7 kDa

Alternative Name(s): Short name:NPTase

Relevance: Highly cationic enzyme that can bind human or rat immunoglobulins as well as serum albumin, and could therefore be involved in post-infectious sequelae.

Reference: "Staphylococcal neutral phosphatase. A highly cationic molecule with binding properties for immunoglobulin."Yousif Y., Schiltz E., Okada K., Batsford S., Vogt A.APMIS 102:891-900(1994)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share