Recombinant Saccharomyces cerevisiae 2-deoxyglucose-6-phosphate phosphatase 1(DOG1)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Saccharomyces cerevisiae 2-deoxyglucose-6-phosphate phosphatase 1(DOG1)

CSB-YP336491SVG
Regular price
$1,263.60 CAD
Sale price
$1,263.60 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170725

Research areas: others

Target / Protein: DOG1

Biologically active: Not Tested

Expression system: Yeast

Species of origin: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Delivery time: 3-7 business days

Uniprot ID: P38774

AA Sequence: MAEFSADLCLFDLDGTIVSTTVAAEKAWTKLCYEYGVDPSELFKHSHGARTQEVLRRFFPKLDDTDNKGVLALEKDIAHSYLDTVSLIPGAENLLLSLDVDTETQKKLPERKWAIVTSGSPYLAFSWFETILKNVGKPKVFITGFDVKNGKPDPEGYSRARDLLRQDLQLTGKQDLKYVVFEDAPVGIKAGKAMGAITVGITSSYDKSVLFDAGADYVVCDLTQVSVVKNNENGIVIQVNNPLTRA

Tag info: N-terminal 6xHis-tagged

Expression Region: 1-246aa

Protein length: Full Length

MW: 29.1 kDa

Alternative Name(s):

Relevance: Active on 2-DOG-6P, also very active on fructose-1P.

Reference: "Molecular characterization of a gene that confers 2-deoxyglucose resistance in yeast."Sanz P., Randez-Gil F., Prieto J.A.Yeast 10:1195-1202(1994)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share