>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20171228
Research areas: Cell Biology
Target / Protein: Try4
Biologically active: Not Tested
Expression system: Yeast
Species of origin: Rattus norvegicus (Rat)
Delivery time: 3-7 business days
Uniprot ID: P12788
AA Sequence: IVGGYTCPKHLVPYQVSLHDGISHQCGGSLISDQWVLSAAHCYKRKLQVRLGEHNIHVLEGGEQFIDAEKIIRHPEYNKDTLDNDIMLIKLKSPAVLNSQVSTVSLPRSCASTDAQCLVSGWGNTVSIGGKYPALLQCLEAPVLSASSCKKSYPGQITSNMFCLGFLEGGKDSCDGDSGGPVVCNGEIQGIVSWGSVCAMRGKPGVYTKVCNYLSWIQETMANN
Tag info: N-terminal 6xHis-tagged
Expression Region: 24-247aa
Protein length: Full Length of Mature Protein
MW: 26.1 kDa
Alternative Name(s): Pretrypsinogen IV Trypsin IV
Relevance:
Reference: "A fourth trypsinogen (P23) in the rat pancreas induced by CCK." Luetcke H.A., Rausch U., Vasiloudes P., Scheele G.A., Kern H.F. Nucleic Acids Res. 17:6736-6736(1989)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.