Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P61365
Gene Names: Ostn
Organism: Rattus norvegicus (Rat)
AA Sequence: SFSGFGSPLDRLSAGSVEHRGKQRRVVDHSKKRFGIPMDRIGRNRLSSSR
Expression Region: 82-131aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 21.6 kDa
Alternative Name(s): Musclin
Relevance: Appears to modulate osteoblastic differentiation. Could also function as an autocrine and paracrine factor linked to glucose metabolism in skeletal muscle
Reference: "Osteocrin, a novel bone-specific secreted protein that modulates the osteoblast phenotype."Thomas G., Moffatt P., Salois P., Gaumond M.-H., Gingras R., Godin E., Miao D., Goltzman D., Lanctot C.J. Biol. Chem. 278:50563-50571(2003)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.