>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Others
Target / Protein: Bglap
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Rattus norvegicus (Rat)
Delivery time: 3-7 business days
Uniprot ID: P04640
AA Sequence: YLNNGLGAPAPYPDPLEPHREVCELNPNCDELADHIGFQDAYKRIYGTTV
Tag info: N-terminal GST-tagged
Expression Region: 50-99aa
Protein length: Full Length
MW: 32.6 kDa
Alternative Name(s): Bone Gla protein ;BGPGamma-carboxyglutamic acid-containing protein
Relevance: Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium.
Reference: Structure of the rat osteocalcin gene and regulation of vitamin D-dependent expression.Lian J., Stewart C., Puchacz E., Mackowiak S., Shalhoub V., Collart D., Zambetti G., Stein G.Proc. Natl. Acad. Sci. U.S.A. 86:1143-1147(1989)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.