Size:20ug. Other sizes are also available. For further information, please contact us.
Research Areas:Immunology
Uniprot ID:Q65Z15
Gene Names:Osm
Organism:Rattus norvegicus (Rat)
AA Sequence:KRGCSSSSPKLLSQLKSQANITGNTASLLEPYILHQNLNTLTLRAACTEHPVAFPSEDMLRQLSKPDFLSTVHATLGRVWHQLGAFRQQFPKIQDFPELERARQNIQGIRNNVYCMARLLHPPLEIPEPTQADSGTSRPTTTAPGIFQIKIDSCRFLWGYHRFMGSVGRVFEEWGDGSRRSRR
Expression Region:26-208aa
Sequence Info:Full Length of Mature Protein
Source:Mammalian cell
Tag Info:N-terminal 10xHis-tagged
MW:24.2 kDa
Alternative Name(s):Osm; Oncostatin-M; OSM
Relevance:Growth regulator. Inhibits the proliferation of a number of tumor cell lines. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells. Uses only type II OSM receptor (heterodimers composed of OSMR and IL6ST). Involved in the maturation of fetal hepatocytes, thereby promoting liver development and regeneration.
Reference:"Oncostatin M inhibits proliferation of rat oval cells, OC15-5, inducing differentiation into hepatocytes." Okaya A., Kitanaka J., Kitanaka N., Satake M., Kim Y., Terada K., Sugiyama T., Takemura M., Fujimoto J., Terada N., Miyajima A., Tsujimura T. Am. J. Pathol. 166:709-719(2005)
Purity:Greater than 85% as determined by SDS-PAGE.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:Growth regulator. Inhibits the proliferation of a number of tumor cell lines. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells (By similarity). Uses only type II OSM receptor (heterodimers composed of OSMR and IL6ST). Involved in the maturation of fetal hepatocytes, thereby promoting liver development and regeneration.
Involvement in disease:
Subcellular Location:Secreted
Protein Families:LIF/OSM family
Tissue Specificity:Widely expressed. Expressed at higher levels in liver, skin and spleen.
Paythway:
HGNC Database Link:
UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Rn&CID=127158
KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?rno:289747
STRING Database Link:https://string-db.org/network/10116.ENSRNOP00000032548
OMIM Database Link:
Lead Time Guidance:3-7 business days