Recombinant Rat Hemopexin(Hpx)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Rat Hemopexin(Hpx)

CSB-EP010723RA
Regular price
$979.56 CAD
Sale price
$979.56 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170725

Research areas: Others

Target / Protein: Hpx

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Rattus norvegicus (Rat)

Delivery time: 3-7 business days

Uniprot ID: P20059

AA Sequence: NPLPAAHETVAKGENGTKPDSDVIEHCSDAWSFDATTMDHNGTMLFFKGEFVWRGHSGIRELISERWKNPVTSVDAAFRGPDSVFLIKEDKVWVYPPEKKENGYPKLFQEEFPGIPYPPDAAVECHRGECQSEGVLFFQGNRKWFWDFATRTQKERSWPAVGNCTAALRWLERYYCFQGNKFLRFNPVTGEVPPRYPLDARDYFISCPGRGHGKLRNGTAHGNSTHPMHSRCNADPGLSALLSDHRGATYAFSGSHYWRLDSSRDGWHSWPIAHHWPQGPSAVDAAFSWDEKVYLIQGTQVYVFLTKGGNNLVSGYPKRLEKELGSPPGISLDTIDAAFSCPGSSKLYVTSGRRLWWLDLKSGAQATWAELSWPHEKVDGALCLEKSLGPYSCSSNGPNLFFIHGPNLYCYSSIDKLNAAKSLPQPQKVNSILGCSQ

Tag info: N-terminal 6xHis-tagged

Expression Region: 24-460aa

Protein length: Full Length of Mature Protein

MW: 52.9 kDa

Alternative Name(s):

Relevance: Binds he and transports it to the liver for breakdown and iron recovery, after which the free hopexin returns to the circulation.

Reference: Rat hemopexin. Molecular cloning, primary structural characterization, and analysis of gene expression.Nikkilae H., Gitlin J.D., Mueller-Eberhard U.Biochemistry 30:823-829(1991)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share