>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170725
Research areas: Others
Target / Protein: Ctsk
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Rattus norvegicus (Rat)
Delivery time: 3-7 business days
Uniprot ID: O35186
AA Sequence: VPDSIDYRKKGYVTPVKNQGQCGSCWAFSSAGALEGQLKKKTGKLLALSPQNLVDCVSENYGCGGGYMTTAFQYVQQNGGIDSEDAYPYVGQDESCMYNATAKAAKCRGYREIPVGNEKALKRAVARVGPVSVSIDASLTSFQFYSRGVYYDENCDRDNVNHAVLVVGYGTQKGNKYWIIKNSWGESWGNKGYVLLARNKNNACGITNLASFPKM
Tag info: N-terminal 6xHis-tagged
Expression Region: 115-329aa
Protein length: Full Length of Mature Protein
MW: 27.5 kDa
Alternative Name(s):
Relevance: Closely involved in osteoclastic bone resorption and may participate partially in the disorder of bone rodeling. Displays potent endoprotease activity against fibrinogen at acid pH. May play an important role in Extracellular domain matrix degradation .
Reference: "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."The MGC Project Team Genome Res. 14:2121-2127(2004)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.