Recombinant Rabies virus Matrix protein(M)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Rabies virus Matrix protein(M)

CSB-EP333055RJA
Regular price
$979.56 CAD
Sale price
$979.56 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171018

Research areas: Others

Target / Protein: M

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Rabies virus (strain CVS-11) (RABV)

Delivery time: 3-7 business days

Uniprot ID: P25223

AA Sequence: MNVLRKIVKKCRDEDTQKPSPVSAPPYDDDLWLPPPEYVPLKELTSKKNMRNFCVNGEVKACSPNGYSFRILRHILGSFNEIYSGNHRMIGLVKVVVGLALSGAPVPEGMNWVYKLRRTLIFQWADSRGPLEGEELEYSQEITWDDDTEFVGLQIRVGARQCHIQGRIWCINSNSRACQLWSDMSLQTQRSEEDKDSSLLLE

Tag info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 1-202aa

Protein length: Full Length of Mature Protein

MW: 28.1 kDa

Alternative Name(s): Phosphoprotein M2

Relevance: Plays a major role in assembly and budding of virion. Completely covers the ribonucleoprotein coil and keep it in condensed bullet-shaped form. Inhibits viral transcription and stimulates replication. Plays a major role in early induction of TRAIL-mediated apoptosis in infected neurons

Reference: "Comparative sequence analysis of the M gene among rabies virus strains and its expression by recombinant vaccinia virus." Hiramatsu K., Mannen K., Mifune K., Nishizono A., Takita-Sonoda Y. Virus Genes 7:83-88(1993)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share