>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20171018
Research areas: Others
Target / Protein: M
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Rabies virus (strain CVS-11) (RABV)
Delivery time: 3-7 business days
Uniprot ID: P25223
AA Sequence: MNVLRKIVKKCRDEDTQKPSPVSAPPYDDDLWLPPPEYVPLKELTSKKNMRNFCVNGEVKACSPNGYSFRILRHILGSFNEIYSGNHRMIGLVKVVVGLALSGAPVPEGMNWVYKLRRTLIFQWADSRGPLEGEELEYSQEITWDDDTEFVGLQIRVGARQCHIQGRIWCINSNSRACQLWSDMSLQTQRSEEDKDSSLLLE
Tag info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region: 1-202aa
Protein length: Full Length of Mature Protein
MW: 28.1 kDa
Alternative Name(s): Phosphoprotein M2
Relevance: Plays a major role in assembly and budding of virion. Completely covers the ribonucleoprotein coil and keep it in condensed bullet-shaped form. Inhibits viral transcription and stimulates replication. Plays a major role in early induction of TRAIL-mediated apoptosis in infected neurons
Reference: "Comparative sequence analysis of the M gene among rabies virus strains and its expression by recombinant vaccinia virus." Hiramatsu K., Mannen K., Mifune K., Nishizono A., Takita-Sonoda Y. Virus Genes 7:83-88(1993)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.