Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Others
Uniprot ID: P20259
Gene Names: N/A
Organism: Pseudechis porphyriacus (Red-bellied black snake)
AA Sequence: NLIQFSNMIKCAIPGSRPLFQYADYGCYCGPGGHGTPVDELDRCCKIHDDCYGEAGKKGCFPKLTLYSWKCTEKVPTCNAKSRCKDFVCACDAEAAKCFAKAPYIKENYNINTKTRC
Expression Region: 1-117aa
Sequence Info: Full Length
Source: Yeast
Tag Info: N-terminal 6xHis-sumostar-tagged
MW: 29 kDa
Alternative Name(s): Phosphatidylcholine 2-acylhydrolase
Relevance: PLA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides.
Reference: "Purification, sequencing and characterization of pseudexin phospholipases A2 from Pseudechis porphyriacus (Australian red-bellied black snake)." Schmidt J.J., Middlebrook J.L. Toxicon 27:805-818(1989)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.