Size:100ug. Other sizes are also available. For further information, please contact us.
Research Areas:Signal Transduction
Uniprot ID:O18766
Gene Names:RHO
Organism:Sus scrofa (Pig)
AA Sequence:MNGTEGPNFYVPFSNKTGVVRSPFEYPQYYLAEPWQ
Expression Region:1-36aa
Sequence Info:Partial
Source:Mammalian cell
Tag Info:N-terminal GST-tagged and C-terminal 6xHis-tagged
MW:34.2 kDa
Alternative Name(s):RHO1
Relevance:Photoreceptor required for image-forming vision at low light intensity. Required for photoreceptor cell viability after birth. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling via G-proteins. Subsequent receptor phosphorylation mediates displacement of the bound G-protein alpha subunit by the arrestin SAG and terminates signaling
Reference:"Structural and functional protein network analyses predict novel signaling functions for rhodopsin." Kiel C., Vogt A., Campagna A., Chatr-aryamontri A., Swiatek-de Lange M., Beer M., Bolz S., Mack A.F., Kinkl N., Cesareni G., Serrano L., Ueffing M. Mol. Syst. Biol. 7:551-551(2011)
Purity:Greater than 85% as determined by SDS-PAGE.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:Photoreceptor required for image-forming vision at low light intensity. Required for photoreceptor cell viability after birth
Involvement in disease:
Subcellular Location:Membrane, Multi-pass membrane protein, Cell projection, cilium, photoreceptor outer segment
Protein Families:G-protein coupled receptor 1 family, Opsin subfamily
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Ssc&CID=16150
KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?ssc:397437
STRING Database Link:https://string-db.org/network/9823.ENSSSCP00000012353
OMIM Database Link:
Lead Time Guidance:18-28 business days