>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Microbiology
Target / Protein:
Biologically active: Not Tested
Expression system: Yeast
Species of origin: Bacillus macerans
Delivery time: 3-7 business days
Uniprot ID: P31835
AA Sequence: VLTADQVTVRFKVNNATTALGQNVYLTGNVAELGNWTAANAIGPMYNQVEASYPTWYFDVSVPANTALQFKFIKVNGSTVTWEGGNNHTFTSPSSGVATVTVDWQN
Tag info: N-terminal 6xHis-tagged
Expression Region: 608-713aa
Protein length: Partial
MW: 13.4 kDa
Alternative Name(s): Cyclodextrin-glycosyltransferase Short name:CGTase
Relevance:
Reference: "Polypeptide possessing cyclomaltodextrin glucanotransferase activity."Sugimoto T., Kubota M., Sakai S.Patent number GB2169902, 23-JUL-1986
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.