Size:20ug. Other sizes are also available. For further information, please contact us.
Research Areas:Others
Uniprot ID:Q6ES52
Gene Names:Os09g0401200
Organism:Oryza sativa subsp. japonica (Rice)
AA Sequence:MATAGASSFEDEIMESDIELEGEAVEPDNDPPQKMGDPSVEVSDEKRDQAQLCKNKGVDAFSEGKLDEAIEHLTEAIVLNPTSAIAYATRAVIFVKSKKPNAAIRDADAALKINPDSAKGYKSRGMAKAMLGKWEEAAQDLRMAAKLDYDEEIGAELKKVEPNVLKIEEHRKKYERLRKERDIKKAEMEKQRKHAEEVSAASAALKDGDVIAIHSSSELDTKLKAASSLSRLVVLYFTAAWCGPCRFIGPVCKSLAEKHRNVVFLKVDIDELNSVAYRWNVSSVPSFFFVRNGKEIDKVVGADKNGLERKVAQHGSS
Expression Region:1-317aa
Sequence Info:Full Length
Source:E.coli
Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW:42.0 kDa
Alternative Name(s):OsTrx26 (Tetratricoredoxin) (OsTDX)
Relevance:Probable thiol-disulfide oxidoreductase that may participate in various redox reactions and act as chaperone under heat shock. May interact with HSP70 proteins through the TPR repeats
Reference:"Comparative genomic study of the thioredoxin family in photosynthetic organisms with emphasis on Populus trichocarpa." Chibani K., Wingsle G., Jacquot J.P., Gelhaye E., Rouhier N. Mol. Plant 2:308-322(2009)
Purity:Greater than 85% as determined by SDS-PAGE.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-81?.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 5? for up to one week.
Function:Probable thiol-disulfide oxidoreductase that may participate in various redox reactions and act as chaperone under heat shock. May interact with HSP70 proteins through the TPR repeats (By similarity).
Involvement in disease:
Subcellular Location:
Protein Families:Thioredoxin family
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Os&CID=15565
KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?osa:4346999
STRING Database Link:
OMIM Database Link:
Lead Time Guidance:3-7 business days