Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Oedogonium cardiacum (Filamentous green alga)
Uniprot NO.:B2X1X7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSQFDTNKLNEIDINKVSLSEVISRPNPNKQVVELNRTSLYWGLLLIFVLAVLFSSYIFN
Protein Names:Recommended name: Photosystem II reaction center protein L Short name= PSII-L Alternative name(s): PSII 5 kDa protein
Gene Names:Name:psbL
Expression Region:1-60
Sequence Info:full length protein