Size:100ug. Other sizes are also available. For further information, please contact us.
Research Areas:Metabolism
Uniprot ID:Q8J0P4
Gene Names:crf1
Organism:Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)
AA Sequence:TYTADFTSASALDQWEVTAGKVPVGPQGAEFTVAKQGDAPTIDTDFYFFFGKAEVVMKAAPGTGVVSSIVLESDDLDEVDWEVLGGDTTQVQTNYFGKGDTTTYDRGTYVPVATPQETFHTYTIDWTKDAVTWSIDGAVVRTLTYNDAKGGTRFPQTPMRLRLGSWAGGDPSNPKGTIEWAGGLTDYSAGPY
Expression Region:42-233aa
Sequence Info:Partial
Source:E.coli
Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW:28.1 kDa
Alternative Name(s):Crh-like protein 1 (Allergen: Asp f 9)
Relevance:
Reference:"Structures of the glycosylphosphatidylinositol membrane anchors from Aspergillus fumigatus membrane proteins." Fontaine T., Magnin T., Melhert A., Lamont D., Latge J.-P., Ferguson M.A.J. Glycobiology 13:169-177(2003)
Purity:Greater than 85% as determined by SDS-PAGE.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:Cell membrane, Lipid-anchor, GPI-anchor, Secreted, cell wall
Protein Families:Glycosyl hydrolase 16 family, CRH1 subfamily
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?afm:AFUA_1G16190
STRING Database Link:
OMIM Database Link:
Lead Time Guidance:3-7 business days