Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Mus musculus (Mouse)
Uniprot NO.:O54885
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:LSPVQAQSDTFPRCDCSSVSPGVLAGIVLGDLVLTLLIALAVYSLGRLVSRGQGTAEGTRKQHIAETESPYQELQGQRPEVYSDLNTQRQYYR
Protein Names:Recommended name: TYRO protein tyrosine kinase-binding protein Alternative name(s): DNAX-activation protein 12 Killer-activating receptor-associated protein Short name= KAR-associated protein
Gene Names:Name:Tyrobp Synonyms:Dap12, Karap
Expression Region:22-114
Sequence Info:full length protein