Recombinant Mouse Serum amyloid A-2 protein(Saa2)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Mouse Serum amyloid A-2 protein(Saa2)

CSB-EP020657MO
Regular price
$1,119.96 CAD
Sale price
$1,119.96 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P05367

Gene Names: Saa2

Organism: Mus musculus (Mouse)

AA Sequence: GFFSFIGEAFQGAGDMWRAYTDMKEAGWKDGDKYFHARGNYDAAQRGPGGVWAAEKISDARESFQEFFGRGHEDTMADQEANRHGRSGKDPNYYRPPGLPAKY

Expression Region: 20-122aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 15.6 kDa

Alternative Name(s): Amyloid fibril protein AA

Relevance: Major acute phase reactant. Apolipoprotein of the HDL complex.

Reference: Structure of the murine serum amyloid A gene family. Gene conversion.Lowell C.A., Potter D.A., Stearman R.S., Morrow J.F.J. Biol. Chem. 261:8442-8452(1986)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share