
Size:100ug. Other sizes are also available. Please contact us.
Research Areas:Signal Transduction
Uniprot NO.:Q08501
Uniprot Entry Name:
Gene Names:Prlr
Species:Mus musculus (Mouse)
Source:Mammalian cell
Expression Region:20-229aa
Sequence:QSPPGKPEIHKCRSPDKETFTCWWNPGSDGGLPTNYSLTYSKEGEKNTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNEMGSSTSDPLYVDVTYIVEPEPPRNLTLEVKQLKDKKTYLWVKWLPPTITDVKTGWFTMEYEIRLKSEEADEWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWGQEKSIEIPNDFTLKD
Protein Description:Partial
Tag Info:C-terminal 10xHis-tagged
Mol. Weight:27.3 kDa
Biological_Activity:Measured by its binding ability in a functional ELISA. Immobilized Mouse Prlr at 5 ?g/mL can bind Anti-PRLR recombinant antibody (CSB-RA018727A0HU), the EC50 is 4.021-8.706 ng/mL.
Purity:Greater than 95% as determined by SDS-PAGE.
Endotoxin:Less than 1.0 EU/ug as determined by LAL method.
Form:Lyophilized powder
Buffer:Lyophilized from a 0.2 ?m filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Alternative Name/ Alias:(PRL-R)
Relevance:This is a receptor for the anterior pituitary hormone prolactin.
PubMed ID:
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link: