>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170725
Research areas: Others
Target / Protein: IL17A
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Macaca mulatta (Rhesus macaque)
Delivery time: 3-7 business days
Uniprot ID: F6T3G5
AA Sequence: GIAIPRNPGCPNSEDKTFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCVNADGNVDYHMNSVPIQQEILVLRREPRHCPNSFRLEKILVSVGCTCVTPIVHHVA
Tag info: N-terminal GST-tagged
Expression Region: 24-155aa
Protein length: Full Length of Mature Protein
MW: 42.1 kDa
Alternative Name(s):
Relevance:
Reference: Genome sequencing and comparison of two nonhuman primate animal models, the cynomolgus and Chinese rhesus macaques.Yan G., Zhang G., Fang X., Zhang Y., Li C., Ling F., Cooper D.N., Li Q., Li Y., van Gool A.J., Du H., Chen J., Chen R., Zhang P., Huang Z., Thompson J.R., Meng Y., Bai Y. , Wang J., Zhuo M., Wang T., Huang Y., Wei L., Li J., Wang Z., Hu H., Yang P., Le L., Stenson P.D., Li B., Liu X., Ball E.V., An N., Huang Q., Zhang Y., Fan W., Zhang X., Li Y., Wang W., Katze M.G., Su B., Nielsen R., Yang H., Wang J., Wang X., Wang J.Nat. Biotechnol. 29:1019-1023(2011)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.