
Size:100ug. Other sizes are also available. Please contact us.
Research Areas:Cell Biology
Uniprot NO.:A0A2K5WSR4
Uniprot Entry Name:
Gene Names:DLL3
Species:Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Source:Mammalian cell
Expression Region:27-490aa
Sequence:AGVFELQIHSFGPGPGPGAPRSPCSARGPCRLFFRVCLKPGLSEEAAESPCALGAALSARGPVYTEQPEAPAPDLPLPNGLLQVPFRDAWPGTFSLIIETWREELGDQIGGPAWSLLARVTRRRRLAAGGPWARDIQRAGAWELRFSYRARCELPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPPVCRAGCSLEHGFCEQPGECRCLEGWTGPLCMVPVSTSSCLGLRGPSSTTTGCLVPGPGPCDGNPCANGGSCSETPGSFECTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRNCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGVSALPAAPPGLRPGDPQR
Protein Description:Partial
Tag Info:C-terminal 6xHis-tagged
Mol. Weight:50.6 kDa
Biological_Activity:Measured by its binding ability in a functional ELISA. Immobilized DLL3 at 2 ?g/mL can bind Anti-DLL3 Recombinant Antibody?CSB-RA882142A1HU?, the EC50 is 1.625-2.702 ng/mL.
Purity:Greater than 82% as determined by SDS-PAGE.
Endotoxin:Less than 1.0 EU/ug as determined by LAL method.
Form:Lyophilized powder
Buffer:Lyophilized from a 0.2 ?m filtered PBS, 6% Trehalose, pH 7.4
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Alternative Name/ Alias:
Relevance:
PubMed ID:
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link: