Recombinant Lolium perenne Major pollen allergen Lol p 5a(LOLPIB)

Recombinant Lolium perenne Major pollen allergen Lol p 5a(LOLPIB)

CSB-EP670318LQK
Regular price
$1,151.28 CAD
Sale price
$1,151.28 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Allergen

Target / Protein: LOLPIB

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Lolium perenne

Delivery time: 3-7 business days

Uniprot ID: Q40240

AA Sequence: ADAGYTPAAAATPATPAATPAAAGGKATTDEQKLLEDVNAGFKAAVAAAANAPPADKFKIFEAAFSESSKGLLATSAAKAPGLIPKLDTAYDVAYKAAEATPEAKYDAFVTALTEALRVIAGALEVHAVKPATEEVLAAKIPTGELQIVDKIDAAFKIAATAANAAPTNDKFTVFESAFNKALNECTGGAYETYKFIPSLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMTQAQKAGKPAAAAATAAATVATAAATAAAVLPPPLLVVQSLISLLIYY

Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Expression Region: 26-307aa

Protein length: Full Length of Mature Protein

MW: 48.4 kDa

Alternative Name(s): Allergen Lol p Ib Allergen Lol p Va Allergen: Lol p 5a

Relevance:

Reference: "Isolation of cDNA encoding a newly identified major allergenic protein of rye-grass pollen: intracellular targeting to the amyloplast." Singh M.B., Hough T., Theerakulpisut P., Avjioglu A., Davies S., Smith P.M., Taylor P., Simpson R.J., Ward L.D., McCluskey J., Puy R., Knox R.B.Proc. Natl. Acad. Sci. U.S.A. 88:1384-1388(1991)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share