Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Cell Biology
Uniprot ID: Q8WVX3
Gene Names: C4orf3
Organism: Homo sapiens (Human)
AA Sequence: MEVDAPGVDGRDGLRERRGFSEGGRQNFDVRPQSGANGLPKHSY
Expression Region: 1-44aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 20.8 kDa
Alternative Name(s): Hepatitis C virus F protein-transactivated protein 1 ;HCV F-transactivated protein 1
Relevance:
Reference: Screening and cloning target genes transactivated by hepatitis C virus F protein using suppression subtractive hybridization technique.Guo J., Cheng J., Ji D., Zhao L.F., Gao X.S., Liu Y., Wu S.H.Zhonghua Gan Zang Bing Za Zhi 13:660-663(2005)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.