Size:100ug. Other sizes are also available. Please contact us.
Research Areas:Cancer
Uniprot NO.:Q07011
Uniprot Entry Name:
Gene Names:TNFRSF9
Species:Homo sapiens (Human)
Source:Mammalian cell
Expression Region:24-186aa
Sequence:LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ
Protein Description:Partial
Tag Info:C-terminal 10xHis-tagged
Mol. Weight:19.1 kDa
Biological_Activity:Measured by its binding ability in a functional ELISA. Immobilized TNFRSF9 at 2 ?g/mL can bind TNFSF9?CSB-MP023997HU1?, the EC50 is 1.011-2.429 ng/mL.
Purity:Greater than 95% as determined by SDS-PAGE.
Endotoxin:Less than 1.0 EU/ug as determined by LAL method.
Form:Lyophilized powder
Buffer:Lyophilized from a 0.2 ?m filtered PBS, 6% Trehalose, pH 7.4
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Alternative Name/ Alias:(4-1BB ligand receptor) (CDw137) (T-cell antigen 4-1BB homolog) (T-cell antigen ILA) (CD antigen CD137)
Relevance:Receptor for TNFSF9/4-1BBL. Possibly active during T cell activation.
PubMed ID:
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link: