Recombinant Human Tumor necrosis factor receptor superfamily member 1B(TNFRSF1B),partial (Active)

Recombinant Human Tumor necrosis factor receptor superfamily member 1B(TNFRSF1B),partial (Active)

CSB-MP023978HU2
Regular price
$561.60 CAD
Sale price
$561.60 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size:100ug. Other sizes are also available. Please contact us.

Research Areas:Cancer

Uniprot NO.:P20333

Uniprot Entry Name:

Gene Names:TNFRSF1B

Species:Homo sapiens (Human)

Source:Mammalian cell

Expression Region:23-257aa

Sequence:LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGD

Protein Description:Partial

Tag Info:C-terminal hFc-tagged

Mol. Weight:54.1 kDa

Biological_Activity:Measured by its binding ability in a functional ELISA. Immobilized TNF-? (CSB-YP023955HU) at 5 ?g/ml can bind human TNFR2, the EC50 of human TNFR2 protein is 1.162-1.481 ng/ml.

Purity:Greater than 95% as determined by SDS-PAGE.

Endotoxin:Less than 1.0 EU/ug as determined by LAL method.

Form:Lyophilized powder

Buffer:Lyophilized from a 0.2 ?m filtered PBS, 6% Trehalose, pH 7.4

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Alternative Name/ Alias:(Tumor necrosis factor receptor 2) (TNF-R2) (Tumor necrosis factor receptor type II) (TNF-RII) (TNFR-II) (p75) (p80 TNF-alpha receptor) (CD120b) (Etanercept) (TBP-2) (TBPII)

Relevance:Receptor with high affinity for TNFSF2/TNF-alpha and approximately 5-fold lower affinity for homotrimeric TNFSF1/lymphotoxin-alpha. The TRAF1/TRAF2 complex recruits the apoptotic suppressors BIRC2 and BIRC3 to TNFRSF1B/TNFR2. This receptor mediates most of the metabolic effects of TNF-alpha. Isoform 2 blocks TNF-alpha-induced apoptosis, which suggests that it regulates TNF-alpha function by antagonizing its biological activity.

PubMed ID:

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

Your list is ready to share