Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Transport
Uniprot ID: P53007
Gene Names: SLC20A3
Organism: Homo sapiens (Human)
AA Sequence: EYVKTQLQLDERSHPPRYRGIGDCVRQTVRSHGVLGLYRGL
Expression Region: 47-87aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 31.8 kDa
Alternative Name(s): Citrate transport protein ;CTPSolute carrier family 25 member 1Tricarboxylate carrier protein
Relevance: Involved in citrate-H+/malate exchange. Important for the bioenergetics of hepatic cells as it provides a carbon source for fatty acid and sterol biosyntheses, and NAD+ for the glycolytic pathway.
Reference: Lysine acetylation targets protein complexes and co-regulates major cellular functions.Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M.Science 325:834-840(2009)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.